PDB entry 4gwb

View 4gwb on RCSB PDB site
Description: Crystal structure of putative Peptide methionine sulfoxide reductase from Sinorhizobium meliloti 1021
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGRC, reductase, PSI-Biology, New York Structural Genomics Research Consortium, OXIDOREDUCTASE
Deposited on 2012-09-01, released 2012-09-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.16
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide methionine sulfoxide reductase MsrA 3
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: msrA3, RA1043, SMa1896
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4gwba_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gwbA (A:)
    mtkravlaggcfwgmqdlirklpgvietrvgytggdvpnatyrnhgthaegieiifdper
    isyrrilelffqihdpttkdrqgndigtsyrsaiyyvddeqkriaqetiadveasglwpg
    kvvtevepvrdfweaepehqnylerypngytchfprpnwvlprrsaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gwbA (A:)
    tkravlaggcfwgmqdlirklpgvietrvgytggdvpnatyrnhgthaegieiifdperi
    syrrilelffqihdpttkdrqgndigtsyrsaiyyvddeqkriaqetiadveasglwpgk
    vvtevepvrdfweaepehqnylerypngytchfprpnwvlprrs