PDB entry 4gw6

View 4gw6 on RCSB PDB site
Description: HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Integrase, DDE motif, allosteric inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-08-31, released 2013-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.199
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • conflict (135)
    Domains in SCOPe 2.05: d4gw6a_
  • Heterogens: ARS, LF2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gw6A (A:)
    mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
    vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
    ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gw6A (A:)
    dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
    tdngsnftsttvkaacwwagikqefgipesmnkelkkiigqvrdqaehlktavqmavfih
    nkkrkgggysagerivdiiatdiq