PDB entry 4gvz

View 4gvz on RCSB PDB site
Description: Crystal structure of arginine kinase in complex with D-arginine, MgADP, and nitrate.
Class: transferase
Keywords: Arginine kinase, Phosphagen kinase, Transferase, Transition state analog, Kinase
Deposited on 2012-08-31, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (Start-356)
      • engineered mutation (102)
      • engineered mutation (111)
      • engineered mutation (115)
    Domains in SCOPe 2.07: d4gvza1, d4gvza2
  • Heterogens: ADP, MG, NO3, DAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gvzA (A:)
    mvdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgven
    ldsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfi
    istrvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqq
    liddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlk
    tvykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledi
    askfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gvzA (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa