PDB entry 4gvu

View 4gvu on RCSB PDB site
Description: Lyngbyastatin 7-Porcine Pancreatic Elastase Co-crystal Structure
Class: hydrolase/hydrolase inhibitor
Keywords: Cyanobacteria, Elastase, Lyngbyastatin 7, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-08-31, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.178
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin-like elastase family member 1
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOPe 2.07: d4gvua_
  • Chain 'B':
    Compound: Lyngbyastatin 7
    Species: Lyngbya [TaxId:28073]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4GVU (0-7)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gvuA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'B':
    No sequence available.