PDB entry 4guz

View 4guz on RCSB PDB site
Description: Structure of the arylamine N-acetyltransferase from Mycobacterium abscessus
Class: Transferase
Keywords: Acetyltransf_2 Transferase, Acetyltransferase, Acetyl CoenzymeA, Cytosol, Transferase
Deposited on 2012-08-30, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable arylamine n-acetyl transferase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_0013c
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1ME52 (6-283)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d4guza1, d4guza2
  • Chain 'B':
    Compound: Probable arylamine n-acetyl transferase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_0013c
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1ME52 (6-283)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d4guzb1, d4guzb2
  • Chain 'C':
    Compound: Probable arylamine n-acetyl transferase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_0013c
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1ME52 (6-283)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d4guzc1, d4guzc2
  • Chain 'D':
    Compound: Probable arylamine n-acetyl transferase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_0013c
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1ME52 (6-283)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d4guzd1, d4guzd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4guzA (A:)
    vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva
    ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv
    vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg
    sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe
    iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4guzB (B:)
    vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva
    ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv
    vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg
    sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe
    iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4guzC (C:)
    vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva
    ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv
    vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg
    sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe
    iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4guzD (D:)
    vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva
    ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv
    vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg
    sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe
    iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq