PDB entry 4gun

View 4gun on RCSB PDB site
Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
Class: oxidoreductase
Keywords: Mn Superoxide Dismutase, OXIDOREDUCTASE
Deposited on 2012-08-29, released 2013-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.239
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4guna1, d4guna2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunb1, d4gunb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunc1, d4gunc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gund1, d4gund2
  • Chain 'E':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gune1, d4gune2
  • Chain 'F':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunf1, d4gunf2
  • Chain 'G':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gung1, d4gung2
  • Chain 'H':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunh1, d4gunh2
  • Chain 'I':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4guni1, d4guni2
  • Chain 'J':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunj1, d4gunj2
  • Chain 'K':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunk1, d4gunk2
  • Chain 'L':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunl1, d4gunl2
  • Chain 'M':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunm1, d4gunm2
  • Chain 'N':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunn1, d4gunn2
  • Chain 'O':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4guno1, d4guno2
  • Chain 'P':
    Compound: superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96UT6 (Start-205)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d4gunp1, d4gunp2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gunA (A:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunA (A:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gunB (B:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunB (B:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gunC (C:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunC (C:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gunD (D:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunD (D:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gunE (E:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunE (E:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gunF (F:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunF (F:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4gunG (G:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunG (G:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4gunH (H:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunH (H:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4gunI (I:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunI (I:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4gunJ (J:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunJ (J:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4gunK (K:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunK (K:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gunL (L:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunL (L:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4gunM (M:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunM (M:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4gunN (N:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunN (N:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4gunO (O:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunO (O:)
    itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
    svveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidi
    tnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyq
    nvrpdyfkaiwnvinwaeaesrysa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4gunP (P:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvrpdyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gunP (P:)
    tenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlks
    vveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlidit
    nsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqyqn
    vrpdyfkaiwnvinwaeaesrysa