PDB entry 4gu9

View 4gu9 on RCSB PDB site
Description: Focal adhesion kinase catalytic domain in complex with (2-Fluoro-phenyl)-(1H-pyrazolo[3,4-d]pyrimidin-4-yl)-amine
Class: Transferase
Keywords: Protein tyrosine kinase, Transferase, ATP binding
Deposited on 2012-08-29, released 2013-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gu9a_
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gu9b_
  • Heterogens: 4GU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gu9A (A:)
    gspstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu9A (A:)
    dyeiqrerielgrcigegqfgdvhqgiymsppalavaiktcknctsdsvrekflqealtm
    rqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstala
    yleskrfvhrdiaarnvlvssndcvklgdflpikwmapesinfrrftsasdvwmfgvcmw
    eilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprftelk
    aqlstileeeka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gu9B (B:)
    gspstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu9B (B:)
    yeiqrerielgrcigegqfgdvhqgiymsppalavaiktcknctsdsvrekflqealtmr
    qfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstalay
    leskrfvhrdiaarnvlvssndcvklgdfglsrymlpikwmapesinfrrftsasdvwmf
    gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
    ftelkaqlstileee