PDB entry 4gu7

View 4gu7 on RCSB PDB site
Description: Crystal structure of DyP-type peroxidase (SCO7193) from Streptomyces coelicolor
Class: oxidoreductase
Keywords: ferridoxin-like, OXIDOREDUCTASE
Deposited on 2012-08-29, released 2013-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.159
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein SCO7193
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gu7a_
  • Chain 'B':
    Compound: Putative uncharacterized protein SCO7193
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gu7b_
  • Chain 'C':
    Compound: Putative uncharacterized protein SCO7193
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gu7c_
  • Chain 'D':
    Compound: Putative uncharacterized protein SCO7193
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gu7d_
  • Heterogens: HEM, NI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gu7A (A:)
    mgsshhhhhhssglvprgshmggeveepepqmvlspltsaaiflvvtidsggedtvrdll
    sdvasleravgfraqpdgrlscvtgigseawdrlfsgarpaglhpfreldgpvhravatp
    gdllfhirasrldlcfalateimgrlrgavtpqdevhgfkyfderdmlgfvdgtenptga
    aarravlvgaedpafaggsyavvqkylhdidaweglsveaqervigrrkmtdvelsddvk
    padshvaltsvtgpdgsdleilrdnmpfgsvgreefgtyfigyartpevtetmlermflg
    tasaphdrildfstavtgslfftpaadfledlparp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu7A (A:)
    epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
    gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
    rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
    lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
    pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
    dfledlparp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gu7B (B:)
    mgsshhhhhhssglvprgshmggeveepepqmvlspltsaaiflvvtidsggedtvrdll
    sdvasleravgfraqpdgrlscvtgigseawdrlfsgarpaglhpfreldgpvhravatp
    gdllfhirasrldlcfalateimgrlrgavtpqdevhgfkyfderdmlgfvdgtenptga
    aarravlvgaedpafaggsyavvqkylhdidaweglsveaqervigrrkmtdvelsddvk
    padshvaltsvtgpdgsdleilrdnmpfgsvgreefgtyfigyartpevtetmlermflg
    tasaphdrildfstavtgslfftpaadfledlparp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu7B (B:)
    epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
    gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
    rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
    lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
    pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
    dfledlparp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gu7C (C:)
    mgsshhhhhhssglvprgshmggeveepepqmvlspltsaaiflvvtidsggedtvrdll
    sdvasleravgfraqpdgrlscvtgigseawdrlfsgarpaglhpfreldgpvhravatp
    gdllfhirasrldlcfalateimgrlrgavtpqdevhgfkyfderdmlgfvdgtenptga
    aarravlvgaedpafaggsyavvqkylhdidaweglsveaqervigrrkmtdvelsddvk
    padshvaltsvtgpdgsdleilrdnmpfgsvgreefgtyfigyartpevtetmlermflg
    tasaphdrildfstavtgslfftpaadfledlparp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu7C (C:)
    epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
    gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
    rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
    lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
    pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
    dfledlparp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gu7D (D:)
    mgsshhhhhhssglvprgshmggeveepepqmvlspltsaaiflvvtidsggedtvrdll
    sdvasleravgfraqpdgrlscvtgigseawdrlfsgarpaglhpfreldgpvhravatp
    gdllfhirasrldlcfalateimgrlrgavtpqdevhgfkyfderdmlgfvdgtenptga
    aarravlvgaedpafaggsyavvqkylhdidaweglsveaqervigrrkmtdvelsddvk
    padshvaltsvtgpdgsdleilrdnmpfgsvgreefgtyfigyartpevtetmlermflg
    tasaphdrildfstavtgslfftpaadfledlparp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu7D (D:)
    epepqmvlspltsaaiflvvtidsggedtvrdllsdvasleravgfraqpdgrlscvtgi
    gseawdrlfsgarpaglhpfreldgpvhravatpgdllfhirasrldlcfalateimgrl
    rgavtpqdevhgfkyfderdmlgfvdgtenptgaaarravlvgaedpafaggsyavvqky
    lhdidaweglsveaqervigrrkmtdvelsddvkpadshvaltsvtgpdgsdleilrdnm
    pfgsvgreefgtyfigyartpevtetmlermflgtasaphdrildfstavtgslfftpaa
    dfledlparp