PDB entry 4gu6

View 4gu6 on RCSB PDB site
Description: FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH N-{3-[(5-Cyano-2-phenyl-1H-pyrrolo[2,3-b]pyridin-4-ylamino)- methyl]-pyridin-2-yl}-N-methyl-methanesulfonamide
Class: transferase/transferase inhibitor
Keywords: Protein tyrosine kinase, ATP binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-08-29, released 2013-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gu6a_
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gu6b_
  • Heterogens: 10N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gu6A (A:)
    gsgstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaqqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu6A (A:)
    dyeiqrerielgrcigegqfgdvhqgiymsnpalavaiktcknctsdsvrekflqealtm
    rqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstala
    yleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesin
    frrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslm
    tkcwaydpsrrprftelkaqlstileeekaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gu6B (B:)
    gsgstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaqqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gu6B (B:)
    yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
    mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
    ayleskrfvhrdiaarnvlvssndcvklgdfglsrlpikwmapesinfrrftsasdvwmf
    gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
    ftelkaqlstileeekaq