PDB entry 4gu2

View 4gu2 on RCSB PDB site
Description: Crystal structure of ubiquitin from Entamoeba histolytica to 1.35 Angstrom
Class: protein binding
Keywords: ubiquitin, ubiquitin-like modifier, ubiquitin fold, post-translational ubiquitination, isopeptide bond, EhUbc5, EhUba1, PROTEIN BINDING
Deposited on 2012-08-29, released 2012-12-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.215
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhUBI1, EHI_083270, EHI_083410, EHI_156660, EHI_178340
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gu2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4gu2A (A:)
snamqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktls
dyniqkestlhlvlrlrggy

    Sequence, based on observed residues (ATOM records): (download) 
    >4gu2A (A:)
mqifvkktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyniqke
stlhlvlr