PDB entry 4gtu

View 4gtu on RCSB PDB site
Description: ligand-free homodimeric human glutathione s-transferase m4-4
Deposited on 1999-05-12, released 2000-01-14
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.245
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuA (A:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuB (B:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuC (C:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuD (D:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuE (E:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuF (F:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuG (G:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuH (H:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk