PDB entry 4gtu

View 4gtu on RCSB PDB site
Description: ligand-free homodimeric human glutathione s-transferase m4-4
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, homodimer
Deposited on 1999-05-12, released 2000-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.245
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtua1, d4gtua2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtub1, d4gtub2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtuc1, d4gtuc2
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtud1, d4gtud2
  • Chain 'E':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtue1, d4gtue2
  • Chain 'F':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtuf1, d4gtuf2
  • Chain 'G':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtug1, d4gtug2
  • Chain 'H':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gtuh1, d4gtuh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuA (A:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuB (B:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuC (C:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuD (D:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuE (E:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuF (F:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuG (G:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gtuH (H:)
    smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqamdvsnqlarvcyspdfe
    klkpeyleelptmmqhfsqflgkrpwfvgdkitfvdflaydvldlhrifepncldafpnl
    kdfisrfeglekisaymkssrflpkplytrvavwgnk