PDB entry 4gts

View 4gts on RCSB PDB site
Description: Engineered RabGGTase in complex with BMS analogue 16
Class: transferase/transferase inhibitor
Keywords: protein prenylation, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-08-29, released 2012-10-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl transferase type-2 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rabggta, Ggta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (Start-236)
    • Uniprot Q08602 (241-329)
      • linker (237-240)
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-2 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rabggtb, Ggtb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gtsb_
  • Heterogens: ZN, CA, 7TP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gtsB (B:)
    gtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmg
    qlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvva
    yvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggf
    gcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcy
    swwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsll
    geeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gtsB (B:)
    qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
    keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
    kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
    eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
    slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
    pvspvfcmpeevlqrvnvqpelvs