PDB entry 4gso

View 4gso on RCSB PDB site
Description: structure of Jararacussin-I
Class: hydrolase
Keywords: Thrombin-like enzyme, hydrolase
Deposited on 2012-08-28, released 2012-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin-like enzyme BjussuSP-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4gsoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4gsoA (A:)
vlggdecdinehpflaflyshgyfcgltlinqewvvtaahcdstnfqmqlgvhskkvlne
deqtrnpkekficpnknmsevldkdimlikldkpisnskhiaplslpsnppsvgsvcrim
gwgsitipnetypdvpycaninlvdyevcqgaynglpakttlcagvleggkdtcvgdsgg
plicngqfqgivsygahscgqgpkpgiytnvfdytdwiqrniagntdatcpp