PDB entry 4gs7

View 4gs7 on RCSB PDB site
Description: Structure of the Interleukin-15 quaternary complex
Class: immune system
Keywords: Cytokine, Cytokine Receptor, Immunoregulatory, anti-tumor, anti-viral, Reductive methylation, IMMUNE SYSTEM
Deposited on 2012-08-27, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4gs7a1, d4gs7a2
  • Chain 'B':
    Compound: Interleukin-2 receptor subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14784
      • engineered mutation (19)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4gs7b1, d4gs7b2
  • Chain 'C':
    Compound: Cytokine receptor common subunit gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31785 (3-End)
      • expression tag (2)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d4gs7c1, d4gs7c2, d4gs7c3
  • Chain 'D':
    Compound: Interleukin-15 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL15RA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gs7d_
  • Heterogens: EDO, ACT, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gs7A (A:)
    mgnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdas
    ihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gs7A (A:)
    mgnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdas
    ihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gs7B (B:)
    adpavqgtsqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqas
    wacnlilgapdsqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvvhv
    ethrcnisweisqashyferhlefeartlspghtweeaplltlkqkqewicletltpdtq
    yefqvrvkplqgefttwspwsqplafrtkpaalgkdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gs7B (B:)
    sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk
    lttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvvhvethrcnisweisqa
    shyferhlefeartlspghtweeaplltlkqkqewicletltpdtqyefqvrvkplqgef
    ttwspwsqplafrtkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gs7C (C:)
    adplplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseei
    tsgcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnlvipwapenltlhklsesqle
    lnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslpsvdgqkrytfrvrsrfnplc
    gsaqhwsewshpihwgsntsken
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gs7C (C:)
    plplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeits
    gcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnlvipwapenltlhklsesqleln
    wnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgs
    aqhwsewshpihwgsn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gs7D (D:)
    mgitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwtt
    pslkcirdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gs7D (D:)
    itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
    lkcirdp