PDB entry 4grz

View 4grz on RCSB PDB site
Description: Crystal structure of SHP1 catalytic domain with PO4
Class: hydrolase
Keywords: Phosphatase domain, Hydrolase
Deposited on 2012-08-27, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 6
    Species: Homo sapiens [TaxId:9606]
    Gene: HCP, PTP1C, PTPN6, SHP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29350 (2-End)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d4grza_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4grzA (A:)
    gsgfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsd
    yinanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnk
    cvpywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdh
    gvpsepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldc
    didiqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grzA (A:)
    gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
    nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
    pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
    psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
    diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkkle