PDB entry 4grr

View 4grr on RCSB PDB site
Description: characterization of N- and C- terminus mutants of human MIF
Class: cytokine, Isomerase
Keywords: alpha/beta mixture, cytokine, Isomerase
Deposited on 2012-08-26, released 2013-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.15
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (3-115)
      • insertion (0-2)
    Domains in SCOPe 2.08: d4grra1, d4grra2
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (3-115)
      • insertion (0-2)
    Domains in SCOPe 2.08: d4grrb1, d4grrb2
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (3-115)
      • insertion (0-2)
    Domains in SCOPe 2.08: d4grrc1, d4grrc2
  • Heterogens: SO4, CL, AVR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4grrA (A:)
    paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
    cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4grrB (B:)
    paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
    cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4grrC (C:)
    paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
    cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa