PDB entry 4grq

View 4grq on RCSB PDB site
Description: Characterization of N- and C- terminus mutants of human MIF
Class: cytokine, Isomerase
Keywords: alpha/beta mixture, cytokine, Isomerase
Deposited on 2012-08-26, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.139
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-115)
      • insertion (1-2)
    Domains in SCOPe 2.08: d4grqa_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-115)
      • insertion (1-2)
    Domains in SCOPe 2.08: d4grqb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-115)
      • insertion (1-2)
    Domains in SCOPe 2.08: d4grqc_
  • Heterogens: CL, SO4, AVL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4grqA (A:)
paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4grqB (B:)
paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4grqC (C:)
paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa