PDB entry 4grp

View 4grp on RCSB PDB site
Description: Crystallographic and biological characterization of N- and C- terminus mutants of human MIF
Class: cytokine, isomerase
Keywords: alpha/beta mixture, cytokine, isomerase
Deposited on 2012-08-26, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: 0.138
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-117)
      • insertion (1-4)
    Domains in SCOPe 2.07: d4grpa_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (Start-117)
      • insertion (1-4)
    Domains in SCOPe 2.07: d4grpb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (Start-117)
      • insertion (1-4)
    Domains in SCOPe 2.07: d4grpc_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4grpA (A:)
paaaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepc
alcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4grpB (B:)
paaaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepc
alcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

    Sequence, based on observed residues (ATOM records): (download) 
    >4grpB (B:)
aaaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4grpC (C:)
paaaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepc
alcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

    Sequence, based on observed residues (ATOM records): (download) 
    >4grpC (C:)
aaaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa