PDB entry 4grn

View 4grn on RCSB PDB site
Description: crystal structure of PAAM mutant of human MIF
Class: cytokine, Isomerase
Keywords: alpha/beta mixture, cytokine and enzyme, cytokine, Isomerase
Deposited on 2012-08-26, released 2013-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: macrophage migration inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Gene: GLIF, human, MIF, MMIF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-115)
    • insertion (1-2)
  Domains in SCOPe 2.08: d4grna_
• Chain 'B':
  Compound: macrophage migration inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Gene: GLIF, human, MIF, MMIF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-115)
    • insertion (1-2)
  Domains in SCOPe 2.08: d4grnb_
• Chain 'C':
  Compound: macrophage migration inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Gene: GLIF, human, MIF, MMIF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-115)
    • insertion (1-2)
  Domains in SCOPe 2.08: d4grnc_
• Heterogens: CL, SO4, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4grnA (A:)
  paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
  cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4grnB (B:)
  paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
  cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4grnC (C:)
  paamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcal
  cslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa