PDB entry 4gra

View 4gra on RCSB PDB site
Description: Crystal structure of SULT1A1 bound with PAP
Class: transferase
Keywords: sulfotransferase, estradiol, hormone regulation, TRANSFERASE
Deposited on 2012-08-24, released 2013-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1A1, STP, STP1, OK/SW-cl.88
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-298)
      • engineered mutation (226)
    Domains in SCOPe 2.08: d4graa_
  • Chain 'B':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1A1, STP, STP1, OK/SW-cl.88
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-298)
      • engineered mutation (226)
    Domains in SCOPe 2.08: d4grab_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4graA (A:)
    gplhmeliqdtsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsq
    ildmiyqggdlekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpq
    tlldqkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhv
    qewwelsrthpvlylfyedmkenpkreiqkilefvgrslpeetvdfmvqhtsfkemkknp
    mtnyttvpqefmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4graA (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvgrslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4graB (B:)
    gplhmeliqdtsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsq
    ildmiyqggdlekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpq
    tlldqkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhv
    qewwelsrthpvlylfyedmkenpkreiqkilefvgrslpeetvdfmvqhtsfkemkknp
    mtnyttvpqefmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4graB (B:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvgrslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel