PDB entry 4gqw

View 4gqw on RCSB PDB site
Description: Crystal structure of CBS-pair protein, CBSX1 (loop deletion) from Arabidopsis thaliana
Class: protein binding
Keywords: CBS domain, Thioredoxin, Chloroplast, plant, PROTEIN BINDING
Deposited on 2012-08-24, released 2013-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.263
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CBS domain-containing protein CBSX1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AP22.61, At4g36910, C7A10.450, CBSX1, CDCP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gqwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4gqwA (A:)
gsgvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydll
aldsgdstwktfnavqkllsktngklvgdlmtpaplvveektnledaakilletkyrrlp
vvdsdgklvgiitrgnvvraalqikrsgdrna

    Sequence, based on observed residues (ATOM records): (download) 
    >4gqwA (A:)
gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal
dtwktfnavqklgklvgdlmtpaplvveektnledaakilletkyrrlpvvdsdgklvgi
itrgnvvraalq