PDB entry 4gqu

View 4gqu on RCSB PDB site
Description: Crystal structure of HisB from Mycobacterium tuberculosis
Class: lyase
Keywords: Mycobacterium tuberculosis, Histidine biosynthesis, Manganese, Class- Alpha and Beta Fold- Ribosomal protein S5 domain 2-like Super family-Ribosomal protein S5 domain 2-like Family- Imidazole glycerol phoshate dehydratase Domain- Imidazole glycerol phosphate dehydratase, Dehydratase, LYASE
Deposited on 2012-08-24, released 2013-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: hisB, MT1637, MTCY336.03c, Rv1601
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gqua1, d4gqua2
  • Heterogens: MN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gquA (A:)
    mhhhhhhtttqtakasrrarierrtresdivieldldgtgqvavdtgvpfydhmltalgs
    hasfdltvratgdveieahhtiedtaialgtalgqalgdkrgirrfgdafipmdetlaha
    avdlsgrpycvhtgepdhlqhttiagssvpyhtvinrhvfeslaanarialhvrvlygrd
    phhiteaqykavaralrqavepdprvsgvpstkgal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gquA (A:)
    srrarierrtresdivieldldgtgqvavdtgvpfydhmltalgshasfdltvratgdve
    ieahhtiedtaialgtalgqalgdkrgirrfgdafipmdetlahaavdlsgrpycvhtge
    pdhlqhttiagssvpyhtvinrhvfeslaanarialhvrvlygrdphhiteaqykavara
    lrqavepdprv