PDB entry 4gqr

View 4gqr on RCSB PDB site
Description: Human Pancreatic alpha-amylase in complex with myricetin
Class: hydrolase/hydrolase inhibitor
Keywords: glycosyl hydrolase, diabetes, obesity, digestion, glycosidase, enzyme inhibition, flavonol, drug design, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-08-23, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.18
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic alpha-amylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gqra1, d4gqra2
  • Heterogens: NAG, CA, CL, MYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gqrA (A:)
    eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl