PDB entry 4gql

View 4gql on RCSB PDB site
Description: Crystal structure of the catalytic domain of Human MMP12 in complex with selective phosphinic inhibitor RXP470.1
Class: hydrolase/hydrolase inhibitor
Keywords: potent selective phosphinic inhibitor, METZINCIN, Zinc protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-08-23, released 2013-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.134
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: HME, MMP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.08: d4gqla1, d4gqla2
  • Heterogens: ZN, CA, R47, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4gqlA (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg