PDB entry 4gq7

View 4gq7 on RCSB PDB site
Description: Crystal structure of Lg-Flo1p
Class: sugar binding protein
Keywords: Carbohydrate binding domain, PA14 domain, SUGAR BINDING PROTEIN
Deposited on 2012-08-22, released 2013-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flocculin
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: Lg-FLO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IUA8 (4-End)
      • expression tag (1-3)
      • see remark 999 (151)
    Domains in SCOPe 2.05: d4gq7a_
  • Heterogens: CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gq7A (A:)
    eaeatqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsi
    yygpntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvg
    gsiafeccaqeqppitstdftingikpwdaaaptdikgstymyagyyypikivysnakal
    arlpvsvvlpdgtevnddfegyvysfdddlsqsnctipdpskht
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gq7A (A:)
    aeatqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiy
    ygpntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvgg
    siafeccaqeqppitstdftingikpwdaaaptdikgstymyagyyypikivysnakala
    rlpvsvvlpdgtevnddfegyvysfdddlsqsnctipdps