PDB entry 4gpr

View 4gpr on RCSB PDB site
Description: Crystal structure of EhUbc5, a ubiquitin conjugating enzyme from Entamoeba histolytica
Class: ligase
Keywords: E2, Ubiquitin conjugating enzyme, ubiquitin conjugation, EhUba1, EhRING1, thiol esterification, LIGASE
Deposited on 2012-08-21, released 2012-12-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme family protein
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_070750, EHI_083560, EhUbc5
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4M5T2 (3-150)
      • expression tag (1-2)
    Domains in SCOPe 2.02: d4gpra_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4gprA (A:)
saamamrriqkelreiqqdppcncsagpvgddifhwtatitgpddspyqgglffldvhfp
vdypfkaprvtfmtkvyhpninkngvicldilkdqwspaltlsrvllsisslltdpnpsd
pldpevanvlrankkqfedtarewtrmyarp

    Sequence, based on observed residues (ATOM records): (download) 
    >4gprA (A:)
aamamrriqkelreiqqdppcncsagpvgddifhwtatitgpddspyqgglffldvhfpv
dypfkaprvtfmtkvyhpninkngvicldilkdqwspaltlsrvllsisslltdpnpsdp
ldpevanvlrankkqfedtarewtrmyarp