PDB entry 4gpn

View 4gpn on RCSB PDB site
Description: The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate.
Class: hydrolase
Keywords: structural genomics, psi-biology, protein structure initiative, midwest center for structural genomics, mcsg, hydrolase
Deposited on 2012-08-21, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-D-Glucosidase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: bgl, SMU_1601
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DT00 (3-479)
      • expression tag (2)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d4gpna1, d4gpna2
  • Chain 'B':
    Compound: 6-phospho-beta-D-Glucosidase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: bgl, SMU_1601
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DT00 (Start-479)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d4gpnb_
  • Heterogens: 6GB, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gpnA (A:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpnA (A:)
    amsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypn
    heaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclk
    ygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinn
    qanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmva
    mcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkd
    lfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglrya
    lnwftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvelmg
    ytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gpnB (B:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpnB (B:)
    sklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypnhe
    aidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclkyg
    iepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinnqa
    nyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmvamc
    piypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkdlf
    egtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglryaln
    wftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvelmgyt
    pwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi