PDB entry 4gpf

View 4gpf on RCSB PDB site
Description: Structure of the Fe3+-biliverdin-HmuO, heme oxygenase from Corynebacterium diphtheriae (data set III)
Class: Oxidoreductase
Keywords: helix, heme degradation, heme, Oxidoreductase
Deposited on 2012-08-20, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpfa_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpfb_
  • Chain 'C':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpfc_
  • Heterogens: BLA, FE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gpfA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpfA (A:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gpfB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpfB (B:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gpfC (C:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpfC (C:)
    aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
    sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
    vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
    sdeqrehllkeatdafvfnhqvfadlgk