PDB entry 4gpd

View 4gpd on RCSB PDB site
Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution
Deposited on 1988-01-04, released 1989-07-12
The last revision prior to the SCOP 1.65 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd1 (1:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd2 (2:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd3 (3:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd4 (4:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa