PDB entry 4gpd

View 4gpd on RCSB PDB site
Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution
Class: oxidoreductase(aldehyde(d)-nad(a))
Keywords: oxidoreductase(aldehyde(d)-nad(a))
Deposited on 1988-01-04, released 1989-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: apo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homarus americanus [TaxId:6706]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gpd11, d4gpd12
  • Chain '2':
    Compound: apo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homarus americanus [TaxId:6706]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gpd21, d4gpd22
  • Chain '3':
    Compound: apo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homarus americanus [TaxId:6706]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gpd31, d4gpd32
  • Chain '4':
    Compound: apo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homarus americanus [TaxId:6706]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gpd41, d4gpd42
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd1 (1:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd2 (2:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd3 (3:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gpd4 (4:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa