PDB entry 4gpc

View 4gpc on RCSB PDB site
Description: Structure of the biliverdin-HmuO, heme oxygenase from Corynebacterium diphtheriae
Class: oxidoreductase
Keywords: helix, heme degradation, heme, Oxidoreductase
Deposited on 2012-08-20, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpca_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpcb_
  • Chain 'C':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpcc_
  • Heterogens: BLA, SO4, ASC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gpcA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpcA (A:)
    ataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdav
    rasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgp
    alvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnl
    elsdeqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gpcB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpcB (B:)
    taglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavr
    asgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpa
    lvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnle
    lsdeqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gpcC (C:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpcC (C:)
    aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
    sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
    vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
    sdeqrehllkeatdafvfnhqvfadlgk