PDB entry 4gpa

View 4gpa on RCSB PDB site
Description: High resolution structure of the GluA4 N-terminal domain (NTD)
Class: transport protein
Keywords: PBP fold, GLUTAMATE RECEPTOR, LIGAND-GATED ION CHANNEL, ION TRANSPORT, Transmembrane AMPA receptor regulating proteins, TARPs, cornichons, CKAMP44, Glycosylation, RNA editing, Cell membrane, Synapse, Extracellular space, TRANSPORT PROTEIN
Deposited on 2012-08-20, released 2012-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glur4, Gria4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gpaa_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gpaA (A:)
    afpssvqigglfirntdqeytafrlaiflhntspnaseapfnlvphvdnietansfavtn
    afcsqysrgvfaifglydkrsvhtltsfcsalhislitpsfptegesqfvlqlrpslrga
    llslldhyewncfvflydtdrgysilqaimekagqngwhvsaicvenfndvsyrqlleel
    drrqekkfvidceierlqnileqivsvgkhvkgyhyiianlgfkdislerfihgganvtg
    fqlvdfntpmvtklmdrwkkldqreypgsetppkytsaltydgvlvmaetfrslrrqkid
    isrrgnagdclanpaapwgqgidmertlkqvriqgltgnvqfdhygrrvnytmdvfelks
    tgprkvgywndmdklvliqdrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpaA (A:)
    fpssvqigglfirntdqeytafrlaiflhntspnaseapfnlvphvdnietansfavtna
    fcsqysrgvfaifglydkrsvhtltsfcsalhislitpsfptegesqfvlqlrpslrgal
    lslldhyewncfvflydtdrgysilqaimekagqngwhvsaicvenfndvsyrqlleeld
    rrqekkfvidceierlqnileqivsvgkhvkgyhyiianlgfkdislerfihgganvtgf
    qlvdfntpmvtklmdrwkkldqreypgsetppkytsaltydgvlvmaetfrslrrqkidi
    srrgnagdclanpaapwgqgidmertlkqvriqgltgnvqfdhygrrvnytmdvfelkst
    gprkvgywndmdklvliqd