PDB entry 4gp0

View 4gp0 on RCSB PDB site
Description: The crystal structure of human fascin 1 R149A K150A R151A mutant
Class: protein binding
Keywords: beta-trefoil, actin bundling protein, cancer, metastasis, cell migration, Actin-binding, Phosphoprotein, PROTEIN BINDING, Actin
Deposited on 2012-08-20, released 2012-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fascin
    Species: Homo sapiens [TaxId:9606]
    Gene: FAN1, FSCN1, HSN, SNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16658 (Start-492)
      • engineered mutation (148-150)
    Domains in SCOPe 2.07: d4gp0a1, d4gp0a2, d4gp0a3, d4gp0a4
  • Chain 'B':
    Compound: fascin
    Species: Homo sapiens [TaxId:9606]
    Gene: FAN1, FSCN1, HSN, SNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16658 (Start-492)
      • engineered mutation (148-150)
    Domains in SCOPe 2.07: d4gp0b1, d4gp0b2, d4gp0b3, d4gp0b4
  • Heterogens: BR, CL, GOL, DTT, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gp0A (A:)
    mtangtaeavqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppdeagsaav
    clrshlgrylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrls
    cfaqtvspaekwsvhiamhpqvniysvtaaayahlsarpadeiavdrdvpwgvdslitla
    fqdqrysvqtadhrflrhdgrlvarpepatgytlefrsgkvafrdcegrylapsgpsgtl
    kagkatkvgkdelfaleqscaqvvlqaanernvstrqgmdlsanqdeetdqetfqleidr
    dtkkcafrthtgkywtltatggvqstassknascyfdiewrdrritlrasngkfvtskkn
    gqlaasvetagdselflmklinrpiivfrgehgfigcrkvtgtldanrssydvfqlefnd
    gaynikdstgkywtvgsdsavtssgdtpvdfffefcdynkvaikvggrylkgdhagvlka
    saetvdpaslwey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gp0A (A:)
    aeavqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppagsaavclrshlgr
    ylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtvsp
    aekwsvhiamhpqvniysvtaaayahlsapadeiavdrdvpwgvdslitlafqdqrysvq
    tadhrflrhdgrlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkvgkde
    lfaleqscaqvvlqaanernvstdlsanqdeetdqetfqleidrdtkkcafrthtgkywt
    ltatggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdself
    lmklinrpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvg
    sdsavtssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gp0B (B:)
    mtangtaeavqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppdeagsaav
    clrshlgrylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrls
    cfaqtvspaekwsvhiamhpqvniysvtaaayahlsarpadeiavdrdvpwgvdslitla
    fqdqrysvqtadhrflrhdgrlvarpepatgytlefrsgkvafrdcegrylapsgpsgtl
    kagkatkvgkdelfaleqscaqvvlqaanernvstrqgmdlsanqdeetdqetfqleidr
    dtkkcafrthtgkywtltatggvqstassknascyfdiewrdrritlrasngkfvtskkn
    gqlaasvetagdselflmklinrpiivfrgehgfigcrkvtgtldanrssydvfqlefnd
    gaynikdstgkywtvgsdsavtssgdtpvdfffefcdynkvaikvggrylkgdhagvlka
    saetvdpaslwey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gp0B (B:)
    eavqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppdagsaavclrshlgr
    ylaadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtvsp
    aekwsvhiamhpqvniysvtaaayahlsarpadeiavdrdvpwgvdslitlafqdqrysv
    qtadhrflrhdgrlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkv
    gkdelfaleqscaqvvlqaanernvstrqgmdlsanqdeetdqetfqleidtkkcafrth
    tgkywtltatggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasveta
    gdselflmklinrpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstg
    kywtvgsdsavtssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpasl
    wey