PDB entry 4gok

View 4gok on RCSB PDB site
Description: The Crystal structure of Arl2GppNHp in complex with UNC119a
Class: signaling protein
Keywords: Small G proteins, Arl, Arf, GDI-like solubilizing factors, Cilia, SIGNALING PROTEIN
Deposited on 2012-08-20, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.248
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: ARL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D0J4 (1-End)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d4goka_
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: ARL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D0J4 (1-End)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d4gokb_
  • Chain 'C':
    Compound: Protein unc-119 homolog A
    Species: Homo sapiens [TaxId:9606]
    Gene: UNC119, RG4
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Protein unc-119 homolog A
    Species: Homo sapiens [TaxId:9606]
    Gene: UNC119, RG4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gokA (A:)
    mlrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvgglkslrs
    ywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalsc
    naiqealeldsirshhwriqgcsavtgedllpgidwllddissrvftad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gokA (A:)
    lrllmlgldnagkttilkkfntisptlgfniktlehrgfklniwdvgglkslrsywrnyf
    estdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscnaiqea
    leldsirshhwriqgcsavtgedllpgidwllddissr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gokB (B:)
    mlrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvgglkslrs
    ywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalsc
    naiqealeldsirshhwriqgcsavtgedllpgidwllddissrvftad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gokB (B:)
    lrllmlgldnagkttilkkftisptlgfniktlehrgfklniwdvgglkslrsywrnyfe
    stdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscnaiqeal
    eldsirshhwriqgcsavtgedllpgidwllddissr
    

  • Chain 'C':
    No sequence available.

  • Chain 'G':
    No sequence available.