PDB entry 4goh

View 4goh on RCSB PDB site
Description: Structure of the substrate-free HmuO, HO from Corynebacterium diphtheriae
Class: Oxidoreductase
Keywords: helix, heme degradation, heme, Oxidoreductase
Deposited on 2012-08-20, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4goha_
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gohA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gohA (A:)
    aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
    sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
    vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
    sdeqrehllkeatdafvfnhqvfadlgkgl