PDB entry 4go9

View 4go9 on RCSB PDB site
Description: CRYSTAL STRUCTURE of the TREHALULOSE SYNTHASE MUTANT, MUTB D415N, in COMPLEX with TRIS
Class: isomerase
Keywords: mutant enzyme, tim-barrel, (beta/alpha)8, sucrose isomerase, glycoside hydrolase, trehalulose synthase, gh13 family (cazy database), calcium binding, isomerase
Deposited on 2012-08-19, released 2013-08-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (Start-556)
      • engineered mutation (414)
    Domains in SCOPe 2.03: d4go9a1, d4go9a2
  • Chain 'B':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PS28 (Start-556)
      • engineered mutation (414)
    Domains in SCOPe 2.03: d4go9b1, d4go9b2
  • Heterogens: CA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4go9A (A:)
    kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
    dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
    npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
    elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
    ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
    dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
    pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrnnartp
    fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgs
    yrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaag
    aaslelqpwqsgiykvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4go9A (A:)
    gapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntdn
    gydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdnp
    yrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklreel
    yamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhek
    vfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtladf
    rqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtpf
    ifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrnnartpfq
    wddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsyr
    didpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaagaa
    slelqpwqsgiykvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4go9B (B:)
    kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
    dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
    npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
    elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
    ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
    dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
    pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrnnartp
    fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgs
    yrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaag
    aaslelqpwqsgiykvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4go9B (B:)
    apwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntdng
    ydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdnpy
    rdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklreely
    amlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhekv
    fdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtladfr
    qtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtpfi
    fqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrnnartpfqw
    ddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgsyrd
    idpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaagaas
    lelqpwqsgiykvk