PDB entry 4gnj

View 4gnj on RCSB PDB site
Description: Crystal Structure Analysis of Leishmania siamensis Triosephosphate Isomerase
Class: isomerase
Keywords: Tim Barrel, ISOMERASE
Deposited on 2012-08-17, released 2013-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.154
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Leishmania sp. siamensis [TaxId:438838]
    Gene: Lstim, tim
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gnja_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Leishmania sp. siamensis [TaxId:438838]
    Gene: Lstim, tim
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gnjb_
  • Heterogens: ARS, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gnjA (A:)
    mgsshhhhhhssglvprgshmsakpqpivaanwkcngttasieklvqvlnehqidhdvqc
    vvapsfvhipmvqaklcnpkyavsaenaiaksgaftgevsmpilkdlgvswvilghserr
    tyygetdgvvaqkvadaynqgfmviacigetlqqreanqtakvvlsqtaaiaaklpkeaw
    sqivlayepvwaigtgkvatpeqaqevhallrqwvsekigngvatklrilyggsvtagna
    ktlymkpdingflvggaslkpefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gnjA (A:)
    kpqpivaanwkcngttasieklvqvlnehqidhdvqcvvapsfvhipmvqaklcnpkyav
    saenaiaksgaftgevsmpilkdlgvswvilghserrtyygetdgvvaqkvadaynqgfm
    viacigetlqqreanqtakvvlsqtaaiaaklpkeawsqivlayepvwaigtkvatpeqa
    qevhallrqwvsekigngvatklrilyggsvtagnaktlymkpdingflvggaslkpefr
    diidatr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gnjB (B:)
    mgsshhhhhhssglvprgshmsakpqpivaanwkcngttasieklvqvlnehqidhdvqc
    vvapsfvhipmvqaklcnpkyavsaenaiaksgaftgevsmpilkdlgvswvilghserr
    tyygetdgvvaqkvadaynqgfmviacigetlqqreanqtakvvlsqtaaiaaklpkeaw
    sqivlayepvwaigtgkvatpeqaqevhallrqwvsekigngvatklrilyggsvtagna
    ktlymkpdingflvggaslkpefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gnjB (B:)
    kpqpivaanwkcngttasieklvqvlnehqidhdvqcvvapsfvhipmvqaklcnpkyav
    saenaiaksgaftgevsmpilkdlgvswvilghserrtyygetdgvvaqkvadaynqgfm
    viacigetlqqreanqtakvvlsqtaaiaaklpkeawsqivlayepvwaigkvatpeqaq
    evhallrqwvsekigngvatklrilyggsvtagnaktlymkpdingflvggaslkpefrd
    iidatr