PDB entry 4gmu

View 4gmu on RCSB PDB site
Description: Structure of rat cytosolic PEPCK Ld_1g in complex with oxalate and GTP
Class: lyase
Keywords: kinase, gluconeogenesis, LYASE
Deposited on 2012-08-16, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PCK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07379 (Start-462)
    • Uniprot P07379 (464-611)
      • linker (463)
    Domains in SCOPe 2.07: d4gmua1, d4gmua2
  • Heterogens: GTP, MN, NA, OXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gmuA (A:)
    mppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahm
    qeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmsee
    dfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsv
    lealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsl
    lgkkcfalriasrlakeegwlaehmlilgitnpegkkkylaaafpsacgktnlammnptl
    pgwkvecvgddiawmkfdaqgnlrainpengffgvapgtsvktnpnaiktiqkntiftnv
    aetsdggvywegideplapgvtitswknkewrpqdeepcahpnsrfctpasqcpiidpaw
    espegvpiegiifggrrpagvplvyealswqhgvfvgaamrsegimhdpfamrpffgynf
    gkylahwlsmahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsa
    kltpigyvpkedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeier
    elralkqrisqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmuA (A:)
    pqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqe
    egvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedf
    ekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvle
    algdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllg
    kkcfalriasrlakeegwlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpg
    wkvecvgddiawmkfdaqgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvae
    tsdggvywegideplapgvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawes
    pegvpiegiifggrrpagvplvyealswqhgvfvgaamrsegimhdpfamrpffgynfgk
    ylahwlsmahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakl
    tpigyvpkedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierel
    ralkqrisqm