PDB entry 4gmt

View 4gmt on RCSB PDB site
Description: Crystal structure of heterosubtypic Fab S139/1
Class: immune system
Keywords: Fab, fragment antigen binding, Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2012-08-16, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.16
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab S139/1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMT (0-End)
  • Chain 'I':
    Compound: Fab S139/1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMT (0-End)
  • Chain 'L':
    Compound: Fab S139/1 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMT (0-End)
    Domains in SCOPe 2.07: d4gmtl1, d4gmtl2
  • Chain 'M':
    Compound: Fab S139/1 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMT (0-End)
    Domains in SCOPe 2.07: d4gmtm1, d4gmtm2
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gmtL (L:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmtL (L:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4gmtM (M:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmtM (M:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne