PDB entry 4glo

View 4glo on RCSB PDB site
Description: Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
Class: Oxidoreductase
Keywords: putative sugar dehydrogenase, enzyme function initiative, EFI, Structural Genomics, Oxidoreductase
Deposited on 2012-08-14, released 2012-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.152
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia multivorans [TaxId:395019]
    Gene: fabG, Bmul_3598, BMULJ_04919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gloa_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia multivorans [TaxId:395019]
    Gene: fabG, Bmul_3598, BMULJ_04919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4glob_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia multivorans [TaxId:395019]
    Gene: fabG, Bmul_3598, BMULJ_04919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gloc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia multivorans [TaxId:395019]
    Gene: fabG, Bmul_3598, BMULJ_04919
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4glod_
  • Heterogens: NAD, SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gloA (A:)
    mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
    pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
    ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
    vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt
    gewlfvdggythldralv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gloB (B:)
    mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
    pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
    ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
    vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt
    gewlfvdggythldralv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gloC (C:)
    mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
    pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
    ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
    vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt
    gewlfvdggythldralv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gloC (C:)
    mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
    pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
    ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
    vipaevmtplyraklaeiaakvplgrrfttpdeiadtavfllsprashttgewlfvdggy
    thldralv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gloD (D:)
    mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
    pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
    ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
    vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt
    gewlfvdggythldralv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gloD (D:)
    mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
    pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
    ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
    vipaevmtplydpeaklaeiaakvplgrrfttpdeiadtavfllsprashttgewlfvdg
    gythldralv