PDB entry 4glm

View 4glm on RCSB PDB site
Description: Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
Class: signaling protein
Keywords: SH3 Domain, DNMBP, Structural Genomics, Structural Genomics Consortium, SGC, Src homology 3 domains, cell junctions, dynamin binding, SIGNALING PROTEIN
Deposited on 2012-08-14, released 2012-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DNMBP, KIAA1010
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (13-68)
      • expression tag (12)
      • expression tag (69)
    Domains in SCOPe 2.05: d4glma_
  • Chain 'B':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DNMBP, KIAA1010
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (13-68)
      • expression tag (12)
    Domains in SCOPe 2.05: d4glmb_
  • Chain 'C':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DNMBP, KIAA1010
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4glmc_
  • Chain 'D':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DNMBP, KIAA1010
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (13-68)
      • expression tag (12)
    Domains in SCOPe 2.05: d4glmd_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4glmA (A:)
    ggaaqpamaqgaltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgif
    pyrfvklcpaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4glmA (A:)
    ltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgifpyrfvklcpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4glmB (B:)
    ggaaqpamaqgaltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgif
    pyrfvklcpaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4glmB (B:)
    ltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgifpyrfvklcp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4glmC (C:)
    ggaaqpamaqgaltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgif
    pyrfvklcpaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4glmC (C:)
    tygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgifpyrfvklcp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4glmD (D:)
    ggaaqpamaqgaltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgif
    pyrfvklcpaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4glmD (D:)
    ltygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgifpyrfvklcp