PDB entry 4glf

View 4glf on RCSB PDB site
Description: Crystal structure of methylthioadenosine phosphorylase sourced from an antarctic soil metagenomic library
Class: transferase
Keywords: methylthioadenosine phosphorylase, methylthioadenosine, rhodamine B, Metagenomic library Antarctic soil, transferase
Deposited on 2012-08-14, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.153
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RsfP
    Species: Uncultured bacterium [TaxId:77133]
    Gene: rsfP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4glfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4glfA (A:)
    mtstaveitvknaadiaiiggsglyqmqaltnkrsvkietpygepsddivlgelngvtva
    fltrhgqghrltpsevpyraniyalktlgvryivsvsavgslqetlkpldmvipdqmidm
    tkqrvstffgdgavahvsmadplcpevadiliraydnadiadgqchakatyvciegpqfs
    traeshwyrqmqadiigmtnmpeaklareasiayatlalvtdfdcwhpneqavsadyaiq
    nlmknadnaqqvikqavaliaseqpksiahtaltqalvtpveamsaetktrlaallp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4glfA (A:)
    knaadiaiiggsglyqmqaltnkrsvkietpygepsddivlgelngvtvafltrhgqghr
    ltpsevpyraniyalktlgvryivsvsavgslqetlkpldmvipdqmidmtkqrvstffg
    dgavahvsmadplcpevadiliraydnadiadgqchakatyvciegpqfstraeshwyrq
    mqadiigmtnmpeaklareasiayatlalvtdfdcwhpneqavsadyaiqnlmknadnaq
    qvikqavaliaseqpksiahtaltqalvtpveamsaetktrlaallp