PDB entry 4gkx

View 4gkx on RCSB PDB site
Description: Crystal structure of a carbohydrate-binding domain
Class: protein transport
Keywords: Protein Transport, Endoplasmic reticulum
Deposited on 2012-08-13, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53, F5F8D, LMAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gkxa_
  • Chain 'B':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53, F5F8D, LMAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gkxb_
  • Chain 'C':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53, F5F8D, LMAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gkxc_
  • Chain 'D':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53, F5F8D, LMAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gkxd_
  • Chain 'E':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53, F5F8D, LMAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gkxe_
  • Chain 'F':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53, F5F8D, LMAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gkxf_
  • Heterogens: CA, 2M4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gkxA (A:)
    mgsshhhhhhssglvprgshmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwah
    agnaipssdqirvapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyae
    nqglegpvfgsadlwngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalas
    cqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaa
    tggladdhdvlsfltfqltep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gkxA (A:)
    lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
    fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
    nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
    tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gkxB (B:)
    mgsshhhhhhssglvprgshmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwah
    agnaipssdqirvapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyae
    nqglegpvfgsadlwngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalas
    cqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaa
    tggladdhdvlsfltfqltep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gkxB (B:)
    lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
    fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
    nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
    tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gkxC (C:)
    mgsshhhhhhssglvprgshmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwah
    agnaipssdqirvapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyae
    nqglegpvfgsadlwngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalas
    cqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaa
    tggladdhdvlsfltfqltep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gkxC (C:)
    lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
    fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
    nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
    tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gkxD (D:)
    mgsshhhhhhssglvprgshmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwah
    agnaipssdqirvapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyae
    nqglegpvfgsadlwngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalas
    cqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaa
    tggladdhdvlsfltfqltep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gkxD (D:)
    lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
    fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
    nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
    tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gkxE (E:)
    mgsshhhhhhssglvprgshmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwah
    agnaipssdqirvapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyae
    nqglegpvfgsadlwngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalas
    cqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaa
    tggladdhdvlsfltfqltep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gkxE (E:)
    lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
    fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
    nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
    tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gkxF (F:)
    mgsshhhhhhssglvprgshmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwah
    agnaipssdqirvapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyae
    nqglegpvfgsadlwngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalas
    cqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaa
    tggladdhdvlsfltfqltep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gkxF (F:)
    lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
    fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
    nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
    tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep