PDB entry 4gjv

View 4gjv on RCSB PDB site
Description: Streptavidin-S112H
Class: Biotin-binding protein
Keywords: artificial metalloenyzme, artificial transfer hydrogenase, beta barrel, tetramer, biotin, iridium pentamethylcyclopentadienyl, Biotin-binding protein
Deposited on 2012-08-10, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • expression tag (12)
      • engineered mutation (111)
    Domains in SCOPe 2.07: d4gjva1, d4gjva2
  • Heterogens: 0OD, CL, RH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gjvA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllthgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjvA (A:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwllthgtteanawkstlvghdtftk
    vk