PDB entry 4gjq

View 4gjq on RCSB PDB site
Description: Crystal structure of human GLTP bound with 12:0 monosulfatide (orthorhombic form;two subunits in asymmetric unit)
Class: lipid transport
Keywords: GLTP-fold, lipid transport
Deposited on 2012-08-10, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gjqa_
  • Chain 'B':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gjqb_
  • Heterogens: CIS, HEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gjqA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjqA (A:)
    llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
    rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
    atkayemalkkyhgwivqkifqaalyaapyksdflkalsvteeeclekirlflvnytati
    dviyemytqmnaelnykv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gjqB (B:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjqB (B:)
    llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
    rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
    atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
    tatidviyemytqmnaelnykv