PDB entry 4gjg

View 4gjg on RCSB PDB site
Description: Crystal structure of the amino-terminal domain of human cardiac troponin C mutant D2N/V28I/L29Q/G30D (NIQD) in complex with cadmium.
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2012-08-09, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c, slow skeletal and cardiac muscles
  Species: Homo sapiens [TaxId:9606]
  Gene: TNNC, TNNC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
    • engineered mutation (1)
    • engineered mutation (27-29)
  Domains in SCOPe 2.06: d4gjga_
• Heterogens: CD, CA, ACT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4gjgA (A:)
  mndiykaaveqlteeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4gjgA (A:)
  mndiykaaveqlteeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
  idevdegtvdfdeflvmmvrcmkdds