PDB entry 4gjg

View 4gjg on RCSB PDB site
Description: Crystal structure of the amino-terminal domain of human cardiac troponin C mutant D2N/V28I/L29Q/G30D (NIQD) in complex with cadmium.
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2012-08-09, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-88)
      • engineered mutation (1)
      • engineered mutation (27-29)
    Domains in SCOPe 2.07: d4gjga_
  • Heterogens: CD, CA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gjgA (A:)
    mndiykaaveqlteeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjgA (A:)
    mndiykaaveqlteeqknefkaafdifiqdaedgcistkelgkvmrmlgqnptpeelqem
    idevdegtvdfdeflvmmvrcmkdds