PDB entry 4gje

View 4gje on RCSB PDB site
Description: Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in complex with cadmium
Class: contractile protein
Keywords: helix-loop-helix ef-hand motif, contractile protein, calcium sensor, cadmium binding
Deposited on 2012-08-09, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC, TNNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gjea_
  • Heterogens: CD, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gjeA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjeA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdegtvdfdeflvmmvrcmkdds