PDB entry 4giy

View 4giy on RCSB PDB site
Description: tRNA Guanine Transglycosylase in complex with disubstituted lin-benzoguanine inhibitor
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: TIM BARREL, GLYCOSYLTRANSFERASE, QUEUOSINE, BIOSYNTHESIS, TRNA PROCESSING, TRNA, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2012-08-09, released 2013-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • cloning artifact (311)
    Domains in SCOPe 2.08: d4giya_
  • Heterogens: ZN, 0WY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4giyA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4giyA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtadiilgntyhlmlrpgaeriakl
    gglhsfmgwdrpiltdsggyqvmslstkqseegvtflspersieiqhllgsdivmafdec
    tpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadal
    aeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmgvgkpddivgavergidm
    fdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechcavcqkwsrayihhlirag
    eilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfraryf